PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_48179
Common NameKK1_028832, KK1_043424, KK1_049522
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 317aa    MW: 35383.3 Da    PI: 5.1993
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_48179genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.5e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
    C.cajan_48179 16 KGLWSPEEDDKLMNYMMNSGQGCWSDVARNAGLQRCGKSCRLRWINYL 63
                     678*******************************************97 PP

2Myb_DNA-binding52.41.2e-1669112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
    C.cajan_48179  69 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 112
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9331163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-231166IPR009057Homeodomain-like
SuperFamilySSF466896.25E-2814110IPR009057Homeodomain-like
SMARTSM007174.6E-101565IPR001005SANT/Myb domain
PfamPF002493.4E-131663IPR001005SANT/Myb domain
CDDcd001677.11E-91963No hitNo description
PROSITE profilePS5129425.91864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2667119IPR009057Homeodomain-like
SMARTSM007174.9E-1668116IPR001005SANT/Myb domain
PfamPF002491.9E-1569112IPR001005SANT/Myb domain
CDDcd001678.00E-1271111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MRKPEAASGN NNKLRKGLWS PEEDDKLMNY MMNSGQGCWS DVARNAGLQR CGKSCRLRWI  60
NYLRPDLKRG AFSPQEEELI IHLHSLLGNR WSQIAARLPG RTDNEIKNFW NSTIKKRLKN  120
LSSNNTSPNA SESSYEPNNK DLNMAGFTTS NDQHQHPDFM PMFNSSSPSP SMHATVLNSI  180
IDRLPMLEHG LNMPASGGGF FNGTGPCFSQ SGIDHNKGLY LENGGIFGSV NIGAEGEMYV  240
PPLESVSTTS DHNLKVESTC NTDTNNSYFD DINSILNNCN NRAGVENLFQ EELTIGEWDL  300
EELMKDVSSF PFLDFSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271111822128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132019.10.0hypothetical protein PHAVU_011G059800g
TrEMBLA0A151UEN00.0A0A151UEN0_CAJCA; Transcription factor MYB46
STRINGGLYMA12G06180.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.15e-67myb domain protein 83